Antibodies

Jump to Filters
View as table Download
MFSD1 Rabbit Polyclonal Antibody
TA338612

USD 539.00

5 Days

Rabbit Polyclonal Anti-MFSD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MFSD1 antibody: synthetic peptide directed towards the middle region of human MFSD1. Synthetic peptide located within the following region: RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM
MFSD1 Rabbit Polyclonal Antibody
TA320004

USD 570.00

5 Days

Rabbit Polyclonal MFSD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MFSD1 antibody was raised against an 18 amino acid synthetic peptide near the center of human MFSD1.