Antibodies

Jump to Filters
View as table Download
METTL14 Rabbit Polyclonal Antibody
TA339744

USD 539.00

5 Days

Rabbit Polyclonal Anti-METTL14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA1627 antibody: synthetic peptide directed towards the N terminal of human KIAA1627. Synthetic peptide located within the following region: LNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDEL
METTL14 Rabbit Polyclonal Antibody
TA378477

USD 365.00

3 Weeks

METTL14 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human METTL14 (NP_066012.1).
Modifications Unmodified