LONRF3 mouse monoclonal antibody,clone OTI9G7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LONRF3 mouse monoclonal antibody,clone OTI9G7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LONRF3 mouse monoclonal antibody,clone OTI7F7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LONRF3 mouse monoclonal antibody,clone OTI9G7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LONRF3 mouse monoclonal antibody,clone OTI7F7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
LONRF3 mouse monoclonal antibody,clone OTI9G7, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
LONRF3 mouse monoclonal antibody,clone OTI9G7, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
LONRF3 mouse monoclonal antibody,clone OTI7F7, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
LONRF3 mouse monoclonal antibody,clone OTI7F7, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-LONRF3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LONRF3 antibody: synthetic peptide directed towards the N terminal of human LONRF3. Synthetic peptide located within the following region: QPPPPLRVNVVLSGLLGKLFPGPARASQLRHEGNRLYRERQVEAALLKYN |
Rabbit Polyclonal Anti-LONRF3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LONRF3 antibody: synthetic peptide directed towards the middle region of human LONRF3. Synthetic peptide located within the following region: LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG |
LONRF3 mouse monoclonal antibody,clone OTI9G7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LONRF3 mouse monoclonal antibody,clone OTI7F7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |