Antibodies

Jump to Filters
View as table Download
GAL4 (LGALS4) Rabbit Polyclonal Antibody
TA368351

USD 380.00

4 Weeks

LGALS4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LGALS4
GAL4 (LGALS4) Rabbit Polyclonal Antibody
TA372595

USD 380.00

4 Weeks

LGALS4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LGALS4
GAL4 (LGALS4) Rabbit Polyclonal Antibody
TA378008

USD 365.00

3 Weeks

Galectin 4/LGALS4 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Galectin 4/LGALS4 (NP_006140.1).
Lgals4 Rabbit Polyclonal Antibody
TA346427

USD 539.00

5 Days

Rabbit Polyclonal Anti-Lgals4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Lgals4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS