Antibodies

View as table Download

Rabbit Polyclonal antibody to LETM1 (leucine zipper-EF-hand containing transmembrane protein 1)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Cow)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 506 and 723 of LETM1 (Uniprot ID#O95202)

LETM1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LETM1

LETM1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LETM1

Rabbit Polyclonal Anti-LETM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LETM1 antibody: synthetic peptide directed towards the middle region of human LETM1. Synthetic peptide located within the following region: MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN

LETM1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human LETM1

LETM1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LETM1