LDB3 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-283 of human LDB3 (NP_001073585.1). |
| Modifications | Unmodified |
Goat Polyclonal Antibody against LDB3
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KSQNKPEDEADE, from the internal region of the protein sequence according to NP_009009.1. |
Rabbit Polyclonal Anti-LDB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LDB3 antibody: synthetic peptide directed towards the N terminal of human LDB3. Synthetic peptide located within the following region: PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS |
Germany
Japan
United Kingdom
China
