Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-LRRC59 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LRRC59 antibody is: synthetic peptide directed towards the middle region of Human LRRC59. Synthetic peptide located within the following region: KEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKL |
LRRC59 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-244 of human LRRC59 (NP_060979.2). |
| Modifications | Unmodified |
Rabbit polyclonal Anti-LRRC59 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRRC59 antibody: synthetic peptide directed towards the N terminal of human LRRC59. Synthetic peptide located within the following region: TKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKL |
Active filters
Target Symbol
- LRRC59