Rabbit polyclonal anti-LPHN1 antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LPHN1. |
Rabbit polyclonal anti-LPHN1 antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LPHN1. |
Rabbit Polyclonal Anti-LPHN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LPHN1 antibody is: synthetic peptide directed towards the C-terminal region of Human LPHN1. Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK |