Germany
Japan
United Kingdom
China
CD85f Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human LILRA5. AA range:141-190 |
Antibodies
View as table Download
LILRA5 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 63-93 amino acids from the N-terminal region of Human CD85f / LILRA5. |
Rabbit Polyclonal Anti-LILRA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LILRA5 Antibody is: synthetic peptide directed towards the N-terminal region of Human LILRA5. Synthetic peptide located within the following region: GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH |
LILRA5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LILRA5 |
Active filters
Target Symbol
- LILRA5