Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal LGI4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LGI4 antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human LGI4. |
Rabbit Polyclonal LGI4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LGI4 antibody was raised against a 14 amino acid peptide from near the center of human LGI4. |
Rabbit Polyclonal Anti-LGI4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LGI4 antibody is: synthetic peptide directed towards the C-terminal region of Human LGI4. Synthetic peptide located within the following region: GGRFERRTDIPEAEDVYATRHFQAGGDVFLCLTRYIGDSMVRLGLGAGGW |
Rabbit Polyclonal Anti-LGI4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LGI4 antibody is: synthetic peptide directed towards the C-terminal region of Human LGI4. Synthetic peptide located within the following region: LWLEGQPCFVVADASKAGSTTLLCRDGPGFYPHQSLHAWHRDTDAEALEL |
Active filters
Target Symbol
- LGI4