Germany
Japan
United Kingdom
China
KRT13 guinea pig polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (TTTSSASVTTTSNA-C) of Human keratin K13 (formerly also designated cytokeratin 13), coupled to KLH. |
Antibodies
View as table Download
Rabbit polyclonal antibody to Cytokeratin 13 (keratin 13)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Cow, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 198 and 438 of Cytokeratin 13 |
KRT13 (+ KRT10) mouse monoclonal antibody, clone DE-K13, Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Canine, Feline, Human, Zebrafish |
| Conjugation | Unconjugated |
Cytokeratin 13 (KRT13) Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 269-458 of human Cytokeratin 13 (Cytokeratin 13 (KRT13)) (NP_705694.2). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-KRT13 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT13 antibody: synthetic peptide directed towards the C terminal of human KRT13. Synthetic peptide located within the following region: EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP |
KRT13 mouse monoclonal antibody, clone 1C7, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat, Zebrafish |
| Conjugation | Unconjugated |
KRT13 mouse monoclonal antibody, clone 1C7, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
KRT13 mouse monoclonal antibody, clone CK-13, Purified
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
KRT13 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human KRT13 |
Goat Anti-KRT13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TSNASGRRTSDVRRP, from the C Terminus of the protein sequence according to NP_705694.2. |
Rabbit Polyclonal Anti-KRT13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT13 antibody: synthetic peptide directed towards the N terminal of human KRT13. Synthetic peptide located within the following region: TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY |
Cytokeratin 13 (KRT13) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 269-458 of human Cytokeratin 13 (Cytokeratin 13 (KRT13)) (NP_705694.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KRT13