Antibodies

View as table Download

Rabbit Polyclonal Anti-KCNMB3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNMB3

KCNMB3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNMB3

Rabbit polyclonal Anti-sloBeta3 (KCNMB3) (extracellular)

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HYDEEAIRTNPK, corresponding to amino acid residues 134- 145 of rat SloÃ?3. Extracellular loop.

Rabbit Polyclonal Anti-KCNMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMB3 antibody: synthetic peptide directed towards the middle region of human KCNMB3. Synthetic peptide located within the following region: SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC