Rabbit Polyclonal Anti-KCNG4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNG4 |
Rabbit Polyclonal Anti-KCNG4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNG4 |
KCNG4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNG4 |
Rabbit Polyclonal Anti-KCNG4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNG4 antibody: synthetic peptide directed towards the N terminal of human KCNG4. Synthetic peptide located within the following region: QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP |
Rabbit Polyclonal Anti-Kcng4 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Kcng4 antibody is: synthetic peptide directed towards the middle region of RAT Kcng4. Synthetic peptide located within the following region: SDESPEAGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGL |
KCNG4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human KCNG4 (NP_758857.1). |
Modifications | Unmodified |