KLK2 mouse monoclonal antibody, clone OTI5D6 (formerly 5D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KLK2 mouse monoclonal antibody, clone OTI5D6 (formerly 5D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KLK2 mouse monoclonal antibody, clone OTI5D6 (formerly 5D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
In Stock
KLK2 mouse monoclonal antibody,clone 5D6, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
In Stock
KLK2 mouse monoclonal antibody,clone 5D6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
KLK2 mouse monoclonal antibody, clone OTI5D6 (formerly 5D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-KLK2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 235-246 amino acids of Human kallikrein-related peptidase 2 |
Goat Polyclonal Antibody against KLK2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHQSLRPDEDSSHD, from the internal region of the protein sequence according to NP_005542.1; NP_001002231.1. |
Rabbit Polyclonal Anti-KLK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLK2 antibody: synthetic peptide directed towards the middle region of human KLK2. Synthetic peptide located within the following region: KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG |