Rabbit Polyclonal Anti-KIAA2013 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KIAA2013 antibody is: synthetic peptide directed towards the C-terminal region of Human KIAA2013. Synthetic peptide located within the following region: QQDPGLPFLFWFSVASLITLFHLFLFKLIYNEYCGPGAKPLFRSKEDPSV |
Rabbit Polyclonal Anti-KIAA2013 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KIAA2013 antibody is: synthetic peptide directed towards the C-terminal region of Human KIAA2013. Synthetic peptide located within the following region: TDTHTPSGLTVNLTLYYMLSCSPAPLLSPSLSHRERDQMESTLNYEDHCF |
Germany
Japan
United Kingdom
China