Antibodies

View as table Download

Rabbit Polyclonal Anti-Kcnq3 Antibody

Applications WB
Reactivities Mouse, Hamster
Conjugation Unconjugated
Immunogen The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ

KCNQ3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNQ3

KCNQ3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 650-679 amino acids from the C-terminal region of human KCNQ3

Rabbit polyclonal Kv7.3/KCNQ3 (Thr246) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of threonine 246 (G-G-TP-W-K).
Modifications Phospho-specific

Rabbit polyclonal Anti-KV7.3 (KCNQ3)

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide AEGEKKEDNRYSDLKTIIC, corresponding to amino acid residues 668-686 of rat Kv7.3 . Intracellular, C-terminal.

KCNQ3 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNQ3

KCNQ3 rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Nter domain of KCNQ3 protein