Antibodies

Jump to Filters
View as table Download
KCNK9 Rabbit Polyclonal Antibody
TA351318

USD 380.00

In Stock

Rabbit Polyclonal Anti-KCNK9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNK9
KCNK9 Rabbit Polyclonal Antibody
TA338578

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCNK9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK9 antibody: synthetic peptide directed towards the N terminal of human KCNK9. Synthetic peptide located within the following region: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY
Kcnk9 Rabbit Polyclonal Antibody
TA328947

USD 850.00

3 Weeks

Rabbit polyclonal Anti-K2P9.1 (TASK-3)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DDYQQLELVILQSEPHR, corresponding to amino acid residues 57-73 of rat K2P9.1 . Extracellular, near the P1 loop.
KCNK9 Rabbit Polyclonal Antibody
TA377733

USD 365.00

3 Weeks

KCNK9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 265-374 of human KCNK9 (NP_001269463.1).
Modifications Unmodified