Rabbit Polyclonal Anti-KCNK9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNK9 |
Rabbit Polyclonal Anti-KCNK9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNK9 |
Rabbit Polyclonal Anti-KCNK9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNK9 antibody: synthetic peptide directed towards the N terminal of human KCNK9. Synthetic peptide located within the following region: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY |
Rabbit polyclonal Anti-K2P9.1 (TASK-3)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DDYQQLELVILQSEPHR, corresponding to amino acid residues 57-73 of rat K2P9.1 . Extracellular, near the P1 loop. |
KCNK9 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 265-374 of human KCNK9 (NP_001269463.1). |
Modifications | Unmodified |