Antibodies

View as table Download

Rabbit Polyclonal Anti-KCNA7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA7

KCNA7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA7

Rabbit polyclonal Anti-KV1.7

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide TTRKAQEIHGKAPG(C), corresponding to amino acid residues 2-15 of mouse KV1.7. Intracellular, N-terminus.

Rabbit Polyclonal Anti-KCNA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNA7 antibody: synthetic peptide directed towards the C terminal of human KCNA7. Synthetic peptide located within the following region: GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV

KCNA7 rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Cter domain of KCNA7 protein