Rabbit polyclonal ISL2 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This ISL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ISL2. |
Rabbit polyclonal anti-ISL2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ISL2. |
Rabbit Polyclonal Anti-ISL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISL2 antibody: synthetic peptide directed towards the N terminal of human ISL2. Synthetic peptide located within the following region: MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHC |
Rabbit Polyclonal Anti-ISL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISL2 antibody: synthetic peptide directed towards the N terminal of human ISL2. Synthetic peptide located within the following region: MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHA |
Germany
Japan
United Kingdom
China
