Rabbit Polyclonal Anti-Ik
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ik antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ik. Synthetic peptide located within the following region: GIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKRMEADGVEVKRPK |
IK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human IK (NP_006074.2). |
| Modifications | Unmodified |
IK/RED (P555) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 530-580 of Human IK/RED. |
Germany
Japan
United Kingdom
China