Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ITLN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITLN1 antibody: synthetic peptide directed towards the middle region of human ITLN1. Synthetic peptide located within the following region: WTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANA |
Rabbit Polyclonal Anti-ITLN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ITLN1 |
ITLN1 mouse monoclonal antibody, clone AT6C11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ITLN1 mouse monoclonal antibody, clone AT6C11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
LFR polyclonal antibody
| Applications | WB |
| Reactivities | Pig, Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to Human LFR. |
Active filters
Target Symbol
- ITLN1