Antibodies

Jump to Filters
View as table Download
ILDR2 Monoclonal Antibody
TA399373

USD 580.00

5 Weeks

Anti-ILDR2 Reference Antibody (bapotulimab)

Applications Animal Model, ELISA, FACS, FN, Kinetics
Reactivities Human, Mouse
Conjugation Unconjugated
ILDR2 Rabbit Polyclonal Antibody
TA337354

USD 539.00

5 Days

Rabbit Polyclonal Anti-ILDR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ILDR2 antibody is: synthetic peptide directed towards the C-terminal region of Human ILDR2. Synthetic peptide located within the following region: QDDQEDASDDALPPYSELELTRGPSYRGRDLPYHSNSEKKRKKEPAKKTN
ILDR2 Rabbit Polyclonal Antibody
TA337355

USD 539.00

5 Days

Rabbit Polyclonal Anti-ILDR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ILDR2 antibody is: synthetic peptide directed towards the C-terminal region of Human ILDR2. Synthetic peptide located within the following region: AHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQ