Germany
Japan
United Kingdom
China
IL5 Rabbit monoclonal antibody,clone OTIR1G2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Recombinant Anti-IL-5 (Clone 2E3)
| Applications | ELISA, Neutralize |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL5 rat monoclonal antibody, clone TRFK5, Purified
| Applications | ELISA, FC, WB |
| Reactivities | Guinea Pig, Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Il5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Il5 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL |
Rabbit Polyclonal Anti-IL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL |
Rabbit Polyclonal Anti-Interleukin 5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5 |
IL5 rat monoclonal antibody, clone JES1-5A10, Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Il5 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure recombinant Murine IL-5 |
Il5 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure recombinant Murine IL-5 |
Il5 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Highly pure recombinant Murine IL-5 |
Il5 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Highly pure recombinant Murine IL-5 |
IL5 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant hIL-5 (human IL-5). |
Active filters
Target Symbol
- IL5