Antibodies

Jump to Filters
View as table Download
IL13 receptor alpha 2 (IL13RA2) Rabbit Polyclonal Antibody
TA323604

USD 380.00

In Stock

Anti-IL13RA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 43-330 amino acids of human interleukin 13 receptor, alpha 2
IL13 receptor alpha 2 (IL13RA2) Rabbit Polyclonal Antibody
TA323603

USD 380.00

4 Weeks

Anti-IL13RA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 43-330 amino acids of human interleukin 13 receptor, alpha 2
IL13 receptor alpha 2 (IL13RA2) Mouse Monoclonal Antibody [Clone ID: B-D13]
AM31179AF-N

USD 370.00

2 Weeks

IL13 receptor alpha 2 (IL13RA2) mouse monoclonal antibody, clone B-D13, Azide Free

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated
IL13 receptor alpha 2 (IL13RA2) Rabbit Polyclonal Antibody
TA337646

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL13RA2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IL13RA2 antibody: synthetic peptide directed towards the N terminal of human IL13RA2. Synthetic peptide located within the following region: DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL
IL13 receptor alpha 2 (IL13RA2) Rabbit Polyclonal Antibody
TA336224

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL13RA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL13RA2 Antibody: synthetic peptide directed towards the middle region of human IL13RA2. Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP