Rabbit Polyclonal Anti-ZNFN1A5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNFN1A5 Antibody: synthetic peptide directed towards the N terminal of human ZNFN1A5. Synthetic peptide located within the following region: MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGD |
IKZF5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human IKZF5 |
IKZF5 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human IKZF5 |
Germany
Japan
United Kingdom
China
