Antibodies

Jump to Filters
View as table Download
IGSF8 Rabbit Polyclonal Antibody
TA364484

USD 380.00

4 Weeks

IGSF8 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IGSF8
IGSF8 (Center) Rabbit Polyclonal Antibody
AP52177PU-N

USD 580.00

2 Weeks

IGSF8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide (233-262 aa) - KLH conjugated - corresponding to internal domain of human IGSF8.
IGSF8 Rabbit Polyclonal Antibody
TA349350

USD 380.00

In Stock

Rabbit Polyclonal Anti-IGSF8 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IGSF8
IGSF8 Rabbit Polyclonal Antibody
TA342765

USD 539.00

5 Days

Rabbit Polyclonal Anti-IGSF8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IGSF8 antibody: synthetic peptide directed towards the middle region of human IGSF8. Synthetic peptide located within the following region: LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEW
IGSF8 Rabbit Polyclonal Antibody
TA377400

USD 365.00

3 Weeks

IGSF8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-350 of human IGSF8 (NP_443100.1).
Modifications Unmodified