Germany
Japan
United Kingdom
China
Antibodies
View as table Download
IGFBP7 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human IGFBP7 |
Rabbit Polyclonal Anti-IGFBP7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IGFBP7 antibody: synthetic peptide directed towards the C terminal of human IGFBP7. Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH |
IGFBP7 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (> 98 %) recombinant human IGFBP7 |
Goat Anti-IGFBP7 (aa145-159) Antibody
| Applications | WB |
| Reactivities | Mouse (Expected from sequence similarity: Human, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EKAITQVSKGTCEQG, from the internal region of the protein sequence according to NP_001544.1. |
IGFBP7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-282 of human IGFBP7 (NP_001544.1). |
| Modifications | Unmodified |
IGFBP7 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (> 98 %) recombinant human IGFBP7 |
Anti-IGFBP7 antibody(DMC422), IgG1 Chimeric mAb
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- IGFBP7