Rabbit Polyclonal Anti-HRK Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HRK |
Rabbit Polyclonal Anti-HRK Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HRK |
HRK rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HRK |
Rabbit polyclonal Hrk BH3 Domain Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Hrk BH3 Domain antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-50 amino acids from human Hrk BH3 Domain. |
HRK rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | 15 amino acid peptide from near the centre of human HRK (NP_003797). |
HRK rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | 15 amino acid peptide from near the centre of human HRK (NP_003797). |
Rabbit Polyclonal Hrk Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | HRK antibody was raised against a 15 amino acid peptide from near the center of human Hrk. |
Rabbit Polyclonal Anti-HRK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HRK antibody: synthetic peptide directed towards the N terminal of human HRK. Synthetic peptide located within the following region: MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW |