Rabbit Polyclonal Anti-HRG Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HRG |
Rabbit Polyclonal Anti-HRG Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HRG |
HRG rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HRG |
Rabbit Polyclonal Anti-HRG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HRG antibody: synthetic peptide directed towards the middle region of human HRG. Synthetic peptide located within the following region: EVLPLPEANFPSFPLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSM |
Rabbit Polyclonal Anti-HRG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HRG antibody: synthetic peptide directed towards the middle region of human HRG. Synthetic peptide located within the following region: HHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNG |
HRG Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-260 of human HRG (NP_000403.1). |
Modifications | Unmodified |