HOXC5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXC5 |
HOXC5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXC5 |
Rabbit Polyclonal anti-HOXC5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXC5 antibody: synthetic peptide directed towards the middle region of human HOXC5. Synthetic peptide located within the following region: WMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNL |
Rabbit Polyclonal anti-HOXC5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXC5 antibody: synthetic peptide directed towards the middle region of human HOXC5. Synthetic peptide located within the following region: KEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEA |
Rabbit Polyclonal Anti-HOXC5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXC5 antibody: synthetic peptide directed towards the N terminal of human HOXC5. Synthetic peptide located within the following region: MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFP |
Rabbit Polyclonal Anti-HOXC5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXC5 antibody: synthetic peptide directed towards the middle region of human HOXC5. Synthetic peptide located within the following region: KEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEA |