DBNL mouse monoclonal antibody, clone OTI6C9 (formerly 6C9)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DBNL mouse monoclonal antibody, clone OTI6C9 (formerly 6C9)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DBNL mouse monoclonal antibody, clone OTI6C9 (formerly 6C9)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
DBNL mouse monoclonal antibody, clone OTI6C9 (formerly 6C9), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
DBNL mouse monoclonal antibody, clone OTI6C9 (formerly 6C9), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DBNL mouse monoclonal antibody, clone OTI6C9 (formerly 6C9)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against DBNL
Applications | WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AANLSRNGPALQE-C, from the N Terminus of the protein sequence according to NP_054782.2; NP_001014436.1. |
Rabbit Polyclonal Anti-DBNL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DBNL antibody: synthetic peptide directed towards the middle region of human DBNL. Synthetic peptide located within the following region: QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE |
DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |