Rabbit Polyclonal Anti-MIZF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MIZF antibody: synthetic peptide directed towards the middle region of human MIZF. Synthetic peptide located within the following region: FKDRSKLREHLRSHTQEKVVACPTCGGMFANNTKFLDHIRRQTSLDQQHF |
Rabbit polyclonal HINFP Antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HINFP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-346 amino acids from the Central region of human HINFP. |
Rabbit Polyclonal Anti-MIZF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MIZF antibody: synthetic peptide directed towards the middle region of human MIZF. Synthetic peptide located within the following region: NQTNAQGQQEIVYYVLSEAPGEPPPAPEPPSGGIMEKLQGIAEEPEIQMV |
HINFP Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human HINFP |
Germany
Japan
United Kingdom
China
