HEPC (HAMP) (25-85) mouse monoclonal antibody, clone 1F9
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
HEPC (HAMP) (25-85) mouse monoclonal antibody, clone 1F9
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
HEPC (HAMP) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 24~54 amino acids from the Central region of Human Hepcidin / HAMP |
Rabbit Polyclonal Anti-HAMP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HAMP antibody: synthetic peptide directed towards the N terminal of human HAMP. Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM |
HAMP Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HAMP |