Antibodies

Jump to Filters
View as table Download
HAUS3 (Center) Rabbit Polyclonal Antibody
AP52003PU-N

USD 580.00

2 Weeks

HAUS3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 379-408 amino acids from the Central region of human HAUS3
HAUS3 Rabbit Polyclonal Antibody
TA333679

USD 539.00

5 Days

Rabbit Polyclonal Anti-HAUS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HAUS3 Antibody is: synthetic peptide directed towards the middle region of Human HAUS3. Synthetic peptide located within the following region: KWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVV
HAUS3 Rabbit Polyclonal Antibody
TA333680

USD 539.00

5 Days

Rabbit Polyclonal Anti-HAUS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HAUS3 Antibody is: synthetic peptide directed towards the N-terminal region of Human HAUS3. Synthetic peptide located within the following region: NAKEEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFFRHSNLGQ
HAUS3 Rabbit Polyclonal Antibody
TA362345

USD 539.00

5 Days

HAUS3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HAUS3