Antibodies

Jump to Filters
View as table Download
HARS Rabbit Polyclonal Antibody
AP06665PU-N

USD 465.00

3 Weeks

HARS rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 361-410 of Human HisRS.
HARS1 Rabbit Polyclonal Antibody
TA313996

USD 380.00

2 Weeks

Rabbit polyclonal anti-HARS antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HARS.
HARS (N-term) Rabbit Polyclonal Antibody
AP14214PU-N

USD 580.00

2 Weeks

HARS (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human HARS.
HARS1 Rabbit Polyclonal Antibody
TA343149

USD 539.00

5 Days

Rabbit Polyclonal Anti-HARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HARS antibody: synthetic peptide directed towards the N terminal of human HARS. Synthetic peptide located within the following region: FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETL