Rabbit polyclonal HAND2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Chicken, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This HAND2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 81-110 amino acids from the Central region of human HAND2. |
Rabbit Polyclonal anti-Hand2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hand2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ |
HAND2 Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-217 of human HAND2 (NP_068808.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
