Rabbit polyclonal anti-GPRC5B antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPRC5B. |
Rabbit polyclonal anti-GPRC5B antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPRC5B. |
Rabbit Polyclonal Anti-GPRC5B Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Dog, Horse, Pig, Rabbit, Chicken, Xenopus, Zebrafish) |
Conjugation | Unconjugated |
Immunogen | RAIG2 / GPRC5B antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPRC5B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Dog, Bovine, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Xenopus, Pufferfish, Zebrafish, Stickleback (94%). |
GPRC5B (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 292-321 amino acids from the C-terminal region of human GPRC5B |
Rabbit Polyclonal Anti-GPRC5B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPRC5B antibody: synthetic peptide directed towards the N terminal of human GPRC5B. Synthetic peptide located within the following region: AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLT |