Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPR21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR21 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR21. Synthetic peptide located within the following region: FRICQQHTKDISERQARFSSQSGETGEVQACPDKRYAMVLFRITSVFYIL |
Rabbit Polyclonal Anti-GPR21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR21 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR21. Synthetic peptide located within the following region: MMLYAPAALIVCFTYFNIFRICQQHTKDISERQARFSSQSGETGEVQACP |
Active filters
Target Symbol
- GPR21