Carrier-free (BSA/glycerol-free) GPC3 mouse monoclonal antibody,clone OTI1G5
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPC3 mouse monoclonal antibody,clone OTI1G5
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
GPC3 mouse monoclonal antibody,clone OTI1G5
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
GPC3 mouse monoclonal antibody,clone OTI1G5
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Mouse Monoclonal Glypican 3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal Anti-GPC3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPC3 antibody: synthetic peptide directed towards the middle region of human GPC3. Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL |
Rabbit anti-GPC3 Polyclonal Antibody
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GPC3 |
Glypican 3 (GPC3) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 464-494 amino acids from the C-terminal region of human GPC3 |