Antibodies

Jump to Filters
View as table Download
Gastric Inhibitory Polypeptide Receptor (GIPR) Rabbit Polyclonal Antibody
TA324940

USD 580.00

5 Days

Rabbit polyclonal GIPR Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GIPR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-38 amino acids from the N-terminal region of human GIPR.
Gastric Inhibitory Polypeptide Receptor (GIPR) Rabbit Polyclonal Antibody
TA313923

USD 380.00

In Stock

Rabbit polyclonal anti-GIPR antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GIPR.
Gastric Inhibitory Polypeptide Receptor (GIPR) Rabbit Polyclonal Antibody
TA350912

USD 380.00

In Stock

Rabbit Polyclonal Anti-GIPR Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GIPR
Gastric Inhibitory Polypeptide Receptor (GIPR) (Center) Rabbit Polyclonal Antibody
AP18034PU-N

USD 580.00

2 Weeks

Gastric Inhibitory Polypeptide Receptor (GIPR) (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 113~142 amino acids from the Center region of Human GIPR.
Gastric Inhibitory Polypeptide Receptor (GIPR) Rabbit Polyclonal Antibody
TA343348

USD 539.00

5 Days

Rabbit Polyclonal Anti-GIPR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GIPR antibody is: synthetic peptide directed towards the N-terminal region of Human GIPR. Synthetic peptide located within the following region: LRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSVAA