Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GTSE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTSE1 antibody: synthetic peptide directed towards the N terminal of human GTSE1. Synthetic peptide located within the following region: NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA |
Rabbit Polyclonal Anti-GTSE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTSE1 antibody: synthetic peptide directed towards the middle region of human GTSE1. Synthetic peptide located within the following region: IDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF |
GTSE1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human GTSE1 (NP_057510.4). |
| Modifications | Unmodified |
GTSE1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human GTSE1 (NP_057510.4). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GTSE1