Antibodies

View as table Download

Anti-GORASP1 (GRASP65) mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey
Conjugation Unconjugated

Anti-GORASP1 (GRASP65) mouse monoclonal antibody, clone OTI5C5 (formerly 5C5)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GORASP1 mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GORASP1 mouse monoclonal antibody, clone OTI5C5 (formerly 5C5)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat
Conjugation Unconjugated

Anti-GORASP1 (GRASP65) mouse monoclonal antibody, clone OTI5G8 (formerly 5G8), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey
Conjugation Biotin

Anti-GORASP1 (GRASP65) mouse monoclonal antibody, clone OTI5G8 (formerly 5G8), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey
Conjugation HRP

Anti-GORASP1 (GRASP65) mouse monoclonal antibody, clone OTI5C5 (formerly 5C5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat
Conjugation Biotin

Anti-GORASP1 (GRASP65) mouse monoclonal antibody, clone OTI5C5 (formerly 5C5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat
Conjugation HRP

Anti-GORASP1 (GRASP65) mouse monoclonal antibody, clone OTI4F8 (formerly 4F8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-GORASP1 (GRASP65) mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GORASP1 mouse monoclonal antibody, clone OTI4F8 (formerly 4F8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-GORASP1 (GRASP65) mouse monoclonal antibody, clone OTI5C5 (formerly 5C5)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-GORASP1 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GORASP1 antibody: synthetic peptide directed towards the N terminal of human GORASP1. Synthetic peptide located within the following region: PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV