Germany
Japan
United Kingdom
China
Rabbit polyclonal antibody to G protein-coupled receptor 45 (G protein-coupled receptor 45)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 192 and 284 of GPR45 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPR45 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR45 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR45. Synthetic peptide located within the following region: LNTSNASDSGSTQLPAPLRISLAIVMLLMTVVGFLGNTVVCIIVYQRPAM |
Rabbit Polyclonal Anti-GPR45 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR45 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR45. Synthetic peptide located within the following region: YVVTLVVAVFFAPFGVMLCAYMCILNTVRKNAVRVHNQSDSLDLRQLTRA |
GPR45 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GPR45 (NP_009158.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GPR45