Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GMFG Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GMFG antibody: synthetic peptide directed towards the middle region of human GMFG. Synthetic peptide located within the following region: KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY |
GMFG (N-term) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-term region of human GMFG. |
GMFG Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human GMFG (NP_004868.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GMFG