Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Tubulin gamma Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Tubulin gamma |
Rabbit Polyclonal Tubulin gamma Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Tubulin gamma. |
Rabbit Polyclonal Anti-TUBG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TUBG2 Antibody: synthetic peptide directed towards the middle region of human TUBG2. Synthetic peptide located within the following region: FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI |
Rabbit anti Tubulin gamma Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to aa 432-451 of human tubulin. |
TUBG1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TUBG1 |
gamma Tubulin (TUBG1) mouse monoclonal antibody, clone IMD-20, Purified
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- GAMMA TUBULIN