GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GADD45A Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human GADD45A (NP_001915.1). |
Modifications | Unmodified |
USD 509.00
2 Weeks
GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GADD45A Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of Human GADD45A. |
Modifications | Unmodified |
Rabbit anti-GADD45A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GADD45A |
GADD45A (N-term) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human GADD45A. |
GADD45A (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human GADD45A |
Rabbit Polyclonal Anti-GADD45A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GADD45A antibody: synthetic peptide directed towards the C terminal of human GADD45A. Synthetic peptide located within the following region: LRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPA |
GADD45A Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GADD45A |