GAA mouse monoclonal antibody, clone 43G7, Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GAA mouse monoclonal antibody, clone 43G7, Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GAA Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL |
GAA (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | conjugated synthetic peptide between 173-203 amino acids from the N-terminal region of Human Alpha-glucosidase |
GAA Rabbit polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human GAA (NP_000143.2). |
Modifications | Unmodified |
GAA Antibody - N-terminal region (ARP44227_P050)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GAA |