aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) aFGF mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-FGF1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1 |
Anti-FGF1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1 |
Rabbit Polyclonal Antibody against FGF1 (N-term)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Pig) |
Conjugation | Unconjugated |
Immunogen | This FGF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 5-30 amino acids from the N-terminal region of human FGF1. |
FGF1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) E.coli derived 16.8 kDa recombinant hFGF-acidic. |
FGF1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) E.coli derived 16.8 kDa recombinant hFGF-acidic. |
FGF1 rabbit polyclonal antibody, Serum
Applications | IHC, R, WB |
Reactivities | Bovine |
Conjugation | Unconjugated |
Immunogen | Recombinant Bovine Fibroblast Growth Factor-1 [FGF-1] (= acidic FGF). |
FGF1 rabbit polyclonal antibody, Serum
Applications | IHC, R, WB |
Reactivities | Bovine |
Conjugation | Unconjugated |
Immunogen | Recombinant Bovine Fibroblast Growth Factor-1 [FGF-1] (= acidic FGF). |
FGF1 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 16-155 of human FGF1 (NP_001138364.1). |
Modifications | Unmodified |
Rabbit Polyclonal Anti-Fgf1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Fgf1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTR |
aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Fgf1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Fgf1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ |