Antibodies

View as table Download

aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) aFGF mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2), HRP conjugated

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-FGF1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1

Anti-FGF1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1

Rabbit Polyclonal Antibody against FGF1 (N-term)

Applications IF, IHC, WB
Reactivities Human (Predicted: Pig)
Conjugation Unconjugated
Immunogen This FGF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 5-30 amino acids from the N-terminal region of human FGF1.

FGF1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived 16.8 kDa recombinant hFGF-acidic.

FGF1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived 16.8 kDa recombinant hFGF-acidic.

FGF1 rabbit polyclonal antibody, Serum

Applications IHC, R, WB
Reactivities Bovine
Conjugation Unconjugated
Immunogen Recombinant Bovine Fibroblast Growth Factor-1 [FGF-1] (= acidic FGF).

FGF1 rabbit polyclonal antibody, Serum

Applications IHC, R, WB
Reactivities Bovine
Conjugation Unconjugated
Immunogen Recombinant Bovine Fibroblast Growth Factor-1 [FGF-1] (= acidic FGF).

FGF1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 16-155 of human FGF1 (NP_001138364.1).
Modifications Unmodified

Rabbit Polyclonal Anti-Fgf1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Fgf1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTR

aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-Fgf1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fgf1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ