Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-FAM98B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAM98B antibody: synthetic peptide directed towards the N terminal of human FAM98B. Synthetic peptide located within the following region: LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI |
Rabbit polyclonal Anti-FAM98B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAM98B antibody: synthetic peptide directed towards the N terminal of human FAM98B. Synthetic peptide located within the following region: LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI |
FAM98B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human FAM98B (NP_775882.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FAM98B