Antibodies

View as table Download

FAM91A1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FAM91A1

Rabbit Polyclonal Anti-FAM91A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM91A1 antibody is: synthetic peptide directed towards the C-terminal region of Human FAM91A1. Synthetic peptide located within the following region: HLCGYVTMLNASSQLADRKLSDASDERGEPDLASGSDVNGSTESFEMVIE

FAM91A1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FAM91A1

Rabbit Polyclonal Anti-FAM91A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM91A1 Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM91A1. Synthetic peptide located within the following region: RHNYPWNKLPANVRQSLGNSQREYEKQVVLYSIRNQLRYRNNLVKHVKKD