FAM91A1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FAM91A1 |
FAM91A1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FAM91A1 |
Rabbit Polyclonal Anti-FAM91A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FAM91A1 antibody is: synthetic peptide directed towards the C-terminal region of Human FAM91A1. Synthetic peptide located within the following region: HLCGYVTMLNASSQLADRKLSDASDERGEPDLASGSDVNGSTESFEMVIE |
FAM91A1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FAM91A1 |
Rabbit Polyclonal Anti-FAM91A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FAM91A1 Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM91A1. Synthetic peptide located within the following region: RHNYPWNKLPANVRQSLGNSQREYEKQVVLYSIRNQLRYRNNLVKHVKKD |